SCOPe 2.06: Domain d1gfoa_: 1gfo A:

Lineage for d1gfoa_ (1gfo A:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.3: Porins [56935] (5 families)

5. Family f.4.3.1: Porin [56936] (2 proteins)
   trimer, one subunit folds into (16,20) barrel

6. Protein Porin [56937] (5 species)

7. Species Escherichia coli, different sequences [TaxId:562] [56938] (27 PDB entries)

8. Domain d1gfoa_: 1gfo A: [43753]
   complexed with c8e; mutant

Details for d1gfoa_

PDB Entry: 1gfo, 3.3 Å

PDB Description: ompf porin (mutant r132p)

PDB Compounds: (A:) matrix porin outer membrane protein f

SCOPe Domain Sequences for d1gfoa_:

Sequence; same for both SEQRES and ATOM records:

>d1gfoa_ f.4.3.1 (A:) Porin {Escherichia coli, different sequences [TaxId: 562]}
aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
dtaysddffvgpvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf

Timeline for d1gfoa_:

• d1gfoa_ first appeared (with stable ids) in SCOP 1.55, called d1gfo__
  
• d1gfoa_ appears in SCOPe 2.05
  
• d1gfoa_ appears in SCOPe 2.07
  
• d1gfoa_ appears in the current release, SCOPe 2.08