Lineage for d1gfp__ (1gfp -)
- Root: SCOP 1.55
Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) 
Fold f.4: Transmembrane beta-barrels [56924] (3 superfamilies) 
Superfamily f.4.3: Porins [56935] (3 families) 
Family f.4.3.1: Porin [56936] (1 protein) Protein Porin [56937] (4 species) 
Species Escherichia coli, different sequences [TaxId:562] [56938] (10 PDB entries) 
Domain d1gfp__: 1gfp - [43750]
Details for d1gfp__
PDB Entry: 1gfp (more details), 2.7 Å
PDB Description: ompf porin (mutant r42c)
SCOP Domain Sequences for d1gfp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gfp__ f.4.3.1 (-) Porin {Escherichia coli, different sequences}
aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyaclgfkgetqinsdltgygq
weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf
SCOP Domain Coordinates for d1gfp__:
Click to download the PDB-style file with coordinates for d1gfp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gfp__:
- d1gfp__ appears in SCOP 1.57
- d1gfp__ appears in the current release, SCOPe 2.08, called d1gfpa_
View in 3D