Lineage for d2omfa_ (2omf A:)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886206Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 886252Superfamily f.4.3: Porins [56935] (4 families) (S)
  5. 886253Family f.4.3.1: Porin [56936] (1 protein)
    trimer, one subunit folds into (16,20) barrel
  6. 886254Protein Porin [56937] (5 species)
  7. 886259Species Escherichia coli, different sequences [TaxId:562] [56938] (15 PDB entries)
  8. 886262Domain d2omfa_: 2omf A: [43749]
    complexed with c8e

Details for d2omfa_

PDB Entry: 2omf (more details), 2.4 Å

PDB Description: ompf porin
PDB Compounds: (A:) matrix porin outer membrane protein f

SCOP Domain Sequences for d2omfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omfa_ f.4.3.1 (A:) Porin {Escherichia coli, different sequences [TaxId: 562]}
aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf

SCOP Domain Coordinates for d2omfa_:

Click to download the PDB-style file with coordinates for d2omfa_.
(The format of our PDB-style files is described here.)

Timeline for d2omfa_: