SCOP 1.71: Domain d2omf__: 2omf -

Lineage for d2omf__ (2omf -)

1. Root: SCOP 1.71

2. Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.3: Porins [56935] (4 families)

5. Family f.4.3.1: Porin [56936] (1 protein)
   trimer, one subunit folds into (16,20) barrel

6. Protein Porin [56937] (5 species)

7. Species Escherichia coli, different sequences [TaxId:562] [56938] (13 PDB entries)

8. Domain d2omf__: 2omf - [43749]
   complexed with c8e

Details for d2omf__

PDB Entry: 2omf, 2.4 Å

PDB Description: ompf porin

SCOP Domain Sequences for d2omf__:

Sequence; same for both SEQRES and ATOM records:

>d2omf__ f.4.3.1 (-) Porin {Escherichia coli, different sequences}
aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf

Timeline for d2omf__:

• d2omf__ first appeared (with stable ids) in SCOP 1.55
  
• d2omf__ appears in SCOP 1.69
  
• d2omf__ is called d2omfa_ in SCOP 1.73
  
• d2omf__ appears in the current release, SCOPe 2.08, called d2omfa_