SCOPe 2.05: Domain d1bxwa_: 1bxw A:

Lineage for d1bxwa_ (1bxw A:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.1: OMPA-like [56925] (5 families)
   forms (8,10) barrel

5. Family f.4.1.1: Outer membrane protein [56926] (3 proteins)
   automatically mapped to Pfam PF13505

6. Protein Outer membrane protein A (OMPA) transmembrane domain [56927] (1 species)

7. Species Escherichia coli [TaxId:562] [56928] (5 PDB entries)

8. Domain d1bxwa_: 1bxw A: [43743]
   complexed with c8e

Details for d1bxwa_

PDB Entry: 1bxw, 2.5 Å

PDB Description: outer membrane protein a (ompa) transmembrane domain

PDB Compounds: (A:) protein (outer membrane protein a)

SCOPe Domain Sequences for d1bxwa_:

Sequence; same for both SEQRES and ATOM records:

>d1bxwa_ f.4.1.1 (A:) Outer membrane protein A (OMPA) transmembrane domain {Escherichia coli [TaxId: 562]}
mapkdntwytgaklgwsqyhdtglinnngpthenklgagafggyqvnpyvgfemgydwlg
rmpykgsvengaykaqgvqltaklgypitddldiytrlggmvwradtysnvygknhdtgv
spvfaggveyaitpeiatrleyqwtnnigdahtigtrpdngmlslgvsyrfg

Timeline for d1bxwa_:

• d1bxwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1bxwa_ appears in SCOPe 2.04
  
• d1bxwa_ appears in SCOPe 2.06
  
• d1bxwa_ appears in the current release, SCOPe 2.08