Lineage for d1bxwa_ (1bxw A:)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 39230Fold f.4: Transmembrane beta-barrels [56924] (3 superfamilies)
  4. 39231Superfamily f.4.1: Outer membrane protein [56925] (1 family) (S)
  5. 39232Family f.4.1.1: Outer membrane protein [56926] (2 proteins)
  6. 39233Protein Outer membrane protein A (OMPA) transmembrane domain [56927] (1 species)
  7. 39234Species Escherichia coli [TaxId:562] [56928] (2 PDB entries)
  8. 39236Domain d1bxwa_: 1bxw A: [43743]

Details for d1bxwa_

PDB Entry: 1bxw (more details), 2.5 Å

PDB Description: outer membrane protein a (ompa) transmembrane domain

SCOP Domain Sequences for d1bxwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxwa_ f.4.1.1 (A:) Outer membrane protein A (OMPA) transmembrane domain {Escherichia coli}
mapkdntwytgaklgwsqyhdtglinnngpthenklgagafggyqvnpyvgfemgydwlg
rmpykgsvengaykaqgvqltaklgypitddldiytrlggmvwradtysnvygknhdtgv
spvfaggveyaitpeiatrleyqwtnnigdahtigtrpdngmlslgvsyrfg

SCOP Domain Coordinates for d1bxwa_:

Click to download the PDB-style file with coordinates for d1bxwa_.
(The format of our PDB-style files is described here.)

Timeline for d1bxwa_: