Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) |
Family f.3.1.1: Light-harvesting complex subunits [56919] (2 proteins) |
Protein Light-harvesting complex subunits [56920] (4 species) |
Species Rhodospirillum molischianum [TaxId:1083] [56922] (1 PDB entry) |
Domain d1lghh_: 1lgh H: [43738] complexed with bcl, det, hto, lyc |
PDB Entry: 1lgh (more details), 2.4 Å
SCOPe Domain Sequences for d1lghh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lghh_ f.3.1.1 (H:) Light-harvesting complex subunits {Rhodospirillum molischianum [TaxId: 1083]} rslsglteeeaiavhdqfkttfsafiilaavahvlvwvwkpwf
Timeline for d1lghh_: