Lineage for d1lghh_ (1lgh H:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021592Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 3021593Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 3021594Family f.3.1.1: Light-harvesting complex subunits [56919] (2 proteins)
  6. 3021595Protein Light-harvesting complex subunits [56920] (4 species)
  7. 3021636Species Rhodospirillum molischianum [TaxId:1083] [56922] (1 PDB entry)
  8. 3021642Domain d1lghh_: 1lgh H: [43738]
    complexed with bcl, det, hto, lyc

Details for d1lghh_

PDB Entry: 1lgh (more details), 2.4 Å

PDB Description: crystal structure of the light-harvesting complex ii (b800-850) from rhodospirillum molischianum
PDB Compounds: (H:) light harvesting complex II

SCOPe Domain Sequences for d1lghh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lghh_ f.3.1.1 (H:) Light-harvesting complex subunits {Rhodospirillum molischianum [TaxId: 1083]}
rslsglteeeaiavhdqfkttfsafiilaavahvlvwvwkpwf

SCOPe Domain Coordinates for d1lghh_:

Click to download the PDB-style file with coordinates for d1lghh_.
(The format of our PDB-style files is described here.)

Timeline for d1lghh_: