Lineage for d1qlbc_ (1qlb C:)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 38834Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 38835Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 39192Family f.2.1.9: Fumarate reductase respiratory complex transmembrane subunits [56910] (1 protein)
  6. 39193Protein Fumarate reductase respiratory complex transmembrane subunits [56911] (2 species)
  7. 39199Species Wolinella succinogenes [TaxId:844] [56913] (2 PDB entries)
  8. 39202Domain d1qlbc_: 1qlb C: [43724]
    Other proteins in same PDB: d1qlba1, d1qlba2, d1qlba3, d1qlbb1, d1qlbb2, d1qlbd1, d1qlbd2, d1qlbd3, d1qlbe1, d1qlbe2

Details for d1qlbc_

PDB Entry: 1qlb (more details), 2.33 Å

PDB Description: respiratory complex II-like fumarate reductase from Wolinella succinogenes

SCOP Domain Sequences for d1qlbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlbc_ f.2.1.9 (C:) Fumarate reductase respiratory complex transmembrane subunits {Wolinella succinogenes}
mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
pnidykyfdykrth

SCOP Domain Coordinates for d1qlbc_:

Click to download the PDB-style file with coordinates for d1qlbc_.
(The format of our PDB-style files is described here.)

Timeline for d1qlbc_: