SCOPe 2.08: Domain d1qlbc_: 1qlb C:

Lineage for d1qlbc_ (1qlb C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families)
   two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains

5. Family f.21.2.1: Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56910] (2 proteins)
   duplication: consists of two structural repeats; the heme-binding sites are related by pseudo two fold symmetry

6. Protein Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56911] (1 species)

7. Species Wolinella succinogenes [TaxId:844] [56913] (5 PDB entries)

8. Domain d1qlbc_: 1qlb C: [43724]
   Other proteins in same PDB: d1qlba1, d1qlba2, d1qlba3, d1qlbb1, d1qlbb2, d1qlbd1, d1qlbd2, d1qlbd3, d1qlbe1, d1qlbe2
   complexed with ca, f3s, fad, fes, fum, hem, lmt, sf4

Details for d1qlbc_

PDB Entry: 1qlb, 2.33 Å

PDB Description: respiratory complex II-like fumarate reductase from Wolinella succinogenes

PDB Compounds: (C:) fumarate reductase cytochrome b subunit

SCOPe Domain Sequences for d1qlbc_:

Sequence; same for both SEQRES and ATOM records:

>d1qlbc_ f.21.2.1 (C:) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes [TaxId: 844]}
mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
pnidykyfdykrth

Timeline for d1qlbc_:

• d1qlbc_ first appeared (with stable ids) in SCOP 1.55
  
• d1qlbc_ appears in SCOPe 2.07