Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) location - matrix side of the bc1 complex automatically mapped to Pfam PF02271 |
Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins) probably important for the complex assembly, caps the matrix face of cytochrome b |
Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [81520] (3 PDB entries) |
Domain d3bccf_: 3bcc F: [43714] Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc2, d3bccc3, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccg_, d3bcch_, d3bccj_ complexed with amy, fes, hem, sig |
PDB Entry: 3bcc (more details), 3.7 Å
SCOPe Domain Sequences for d3bccf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bccf_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus) [TaxId: 9031]} srwlegirkwyynaagfnkyglmrddtiyenddvkeairrlpenlyddrmfrikraldln mrqqilpkeqwtkyeedvpylepylkevirerkereewdk
Timeline for d3bccf_: