Lineage for d3bccd3 (3bcc D:196-241)
- Root: SCOP 1.57
Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) Fold f.2: Membrane all-alpha [56868] (1 superfamily) Superfamily f.2.1: Membrane all-alpha [56869] (10 families) 
Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein) Protein Cytochrome bc1 transmembrane subunits [56907] (3 species) 
Species Chicken (Gallus gallus) [TaxId:9031] [56909] (3 PDB entries) 
Domain d3bccd3: 3bcc D:196-241 [43712]
Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccd2, d3bcce1
Details for d3bccd3
PDB Entry: 3bcc (more details), 3.7 Å
PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken
SCOP Domain Sequences for d3bccd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bccd3 f.2.1.8 (D:196-241) Cytochrome bc1 transmembrane subunits {Chicken (Gallus gallus)}
pehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrppk
SCOP Domain Coordinates for d3bccd3:
Click to download the PDB-style file with coordinates for d3bccd3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3bccd3:
View in 3D
