Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) |
Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein) |
Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species) interacts with cytochrome c1 and ISP |
Species Chicken (Gallus gallus) [TaxId:9031] [81510] (3 PDB entries) |
Domain d2bccj_: 2bcc J: [43710] Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd2, d2bccd3, d2bcce1, d2bcce2, d2bccf_, d2bccg_, d2bcch_ |
PDB Entry: 2bcc (more details), 3.5 Å
SCOP Domain Sequences for d2bccj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bccj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus)} tltarlysllfrrtstfaltivvgallferafdqgadaiyehinegklwkhikhkyenk
Timeline for d2bccj_: