![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
![]() | Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) ![]() location - intermembrane side of the bc1 complex automatically mapped to Pfam PF02320 |
![]() | Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
![]() | Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [81527] (3 PDB entries) |
![]() | Domain d2bcch_: 2bcc H: [43709] Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd2, d2bccd3, d2bcce1, d2bcce2, d2bccf_, d2bccg_, d2bccj_ complexed with bog, fes, hem, pee, sig, u10 |
PDB Entry: 2bcc (more details), 3.5 Å
SCOPe Domain Sequences for d2bcch_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bcch_ f.28.1.1 (H:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus) [TaxId: 9031]} lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelfdflhardhcvahk lfnslk
Timeline for d2bcch_: