SCOPe 2.01: Domain d1bccj_: 1bcc J:

Lineage for d1bccj_ (1bcc J:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family)

5. Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)

6. Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
   interacts with cytochrome c1 and ISP

7. Species Chicken (Gallus gallus) [TaxId:9031] [81510] (3 PDB entries)

8. Domain d1bccj_: 1bcc J: [43703]
   Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc2, d1bccc3, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_
   complexed with bog, fes, hem, pee, u10

Details for d1bccj_

PDB Entry: 1bcc, 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

PDB Compounds: (J:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1bccj_:

Sequence; same for both SEQRES and ATOM records:

>d1bccj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus) [TaxId: 9031]}
tltarlysllfrrtstfaltivvgallferafdqgadaiyehinegklwkhikhkyenk

Timeline for d1bccj_:

• d1bccj_ first appeared (with stable ids) in SCOP 1.55, called d1bccj1
  
• d1bccj_ appears in SCOP 1.75
  
• d1bccj_ appears in SCOPe 2.02
  
• d1bccj_ appears in the current release, SCOPe 2.08