Lineage for d1bccd3 (1bcc D:196-241)
- Root: SCOP 1.57
Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) Fold f.2: Membrane all-alpha [56868] (1 superfamily) Superfamily f.2.1: Membrane all-alpha [56869] (10 families) 
Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein) Protein Cytochrome bc1 transmembrane subunits [56907] (3 species) 
Species Chicken (Gallus gallus) [TaxId:9031] [56909] (3 PDB entries) 
Domain d1bccd3: 1bcc D:196-241 [43698]
Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccd2, d1bcce1
Details for d1bccd3
PDB Entry: 1bcc (more details), 3.16 Å
PDB Description: cytochrome bc1 complex from chicken
SCOP Domain Sequences for d1bccd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bccd3 f.2.1.8 (D:196-241) Cytochrome bc1 transmembrane subunits {Chicken (Gallus gallus)}
pehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrppk
SCOP Domain Coordinates for d1bccd3:
Click to download the PDB-style file with coordinates for d1bccd3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bccd3:
View in 3D
