Details for d1bgyv_

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1bgyv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyv_ f.23.14.1 (V:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
nk

SCOP Domain Coordinates for d1bgyv_:

Click to download the PDB-style file with coordinates for d1bgyv_.
(The format of our PDB-style files is described here.)

Timeline for d1bgyv_: