Lineage for d1bgys_ (1bgy S:)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887523Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
  5. 887524Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein)
  6. 887525Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 887541Species Cow (Bos taurus) [TaxId:9913] [81503] (18 PDB entries)
    Uniprot P13271 #SP
    Uniprot P13271
    Uniprot P13271 #SP ! Uniprot P13271
  8. 887562Domain d1bgys_: 1bgy S: [43693]
    Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyb1, d1bgyb2, d1bgyc2, d1bgyc3, d1bgyd2, d1bgyd3, d1bgye_, d1bgyf_, d1bgyh_, d1bgyj_, d1bgyk_, d1bgym1, d1bgym2, d1bgyn1, d1bgyn2, d1bgyo2, d1bgyo3, d1bgyp2, d1bgyp3, d1bgyq1, d1bgyq2, d1bgyr_, d1bgyt_, d1bgyv_, d1bgyw_
    complexed with fes, hec, hem

Details for d1bgys_

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine
PDB Compounds: (S:) cytochrome bc1 complex

SCOP Domain Sequences for d1bgys_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgys_ f.23.13.1 (S:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpaayendr

SCOP Domain Coordinates for d1bgys_:

Click to download the PDB-style file with coordinates for d1bgys_.
(The format of our PDB-style files is described here.)

Timeline for d1bgys_: