Lineage for d1bgys1 (1bgy S:)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 87593Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 87594Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 87917Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)
  6. 87918Protein Cytochrome bc1 transmembrane subunits [56907] (3 species)
  7. 87949Species Cow (Bos taurus) [TaxId:9913] [56908] (3 PDB entries)
  8. 87978Domain d1bgys1: 1bgy S: [43693]
    Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyb1, d1bgyb2, d1bgyd2, d1bgym1, d1bgym2, d1bgyn1, d1bgyn2, d1bgyp2, d1bgyq1

Details for d1bgys1

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1bgys1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgys1 f.2.1.8 (S:) Cytochrome bc1 transmembrane subunits {Cow (Bos taurus)}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpaayendr

SCOP Domain Coordinates for d1bgys1:

Click to download the PDB-style file with coordinates for d1bgys1.
(The format of our PDB-style files is described here.)

Timeline for d1bgys1: