SCOP 1.73: Domain d1qcrk_: 1qcr K:

Lineage for d1qcrk_ (1qcr K:)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family)

5. Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (1 protein)

6. Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species)
   the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located

7. Species Cow (Bos taurus) [TaxId:9913] [81515] (10 PDB entries)

8. Domain d1qcrk_: 1qcr K: [43680]
   Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrc2, d1qcrc3, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrf_, d1qcrg_, d1qcrh_, d1qcrj_
   complexed with hem

Details for d1qcrk_

PDB Entry: 1qcr, 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

PDB Compounds: (K:) ubiquinol cytochrome c oxidoreductase

SCOP Domain Sequences for d1qcrk_:

Sequence; same for both SEQRES and ATOM records:

>d1qcrk_ f.23.15.1 (K:) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
mltrflgpryrqlarnwvptaqlwgavgavglvsatdsrlildwv

Timeline for d1qcrk_:

• d1qcrk_ first appeared (with stable ids) in SCOP 1.55, called d1qcrk1
  
• d1qcrk_ appears in SCOP 1.71
  
• d1qcrk_ appears in SCOP 1.75
  
• d1qcrk_ appears in the current release, SCOPe 2.08