SCOP 1.65: Domain d1qcrf_: 1qcr F:

Lineage for d1qcrf_ (1qcr F:)

1. Root: SCOP 1.65

2. Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (1 protein)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81519] (5 PDB entries)

8. Domain d1qcrf_: 1qcr F: [43676]
   Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrc2, d1qcrc3, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrg_, d1qcrh_, d1qcrj_, d1qcrk_
   complexed with hem

Details for d1qcrf_

PDB Entry: 1qcr, 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

SCOP Domain Sequences for d1qcrf_:

Sequence; same for both SEQRES and ATOM records:

>d1qcrf_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
assrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikrald
lsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

Timeline for d1qcrf_:

• d1qcrf_ first appeared (with stable ids) in SCOP 1.55, called d1qcrf1
  
• d1qcrf_ appears in SCOP 1.63
  
• d1qcrf_ appears in SCOP 1.67
  
• d1qcrf_ appears in the current release, SCOPe 2.08