Lineage for d1qcre2 (1qcr E:1-69)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254371Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 2254372Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 2254373Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 2254389Species Cow (Bos taurus) [TaxId:9913] [81497] (18 PDB entries)
    Uniprot P13272; precursor of chains I,E and V,R
  8. 2254411Domain d1qcre2: 1qcr E:1-69 [43675]
    Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrc2, d1qcrc3, d1qcrd2, d1qcrd3, d1qcre1, d1qcrf_, d1qcrg_, d1qcrh_, d1qcrj_, d1qcrk_
    complexed with hem

Details for d1qcre2

PDB Entry: 1qcr (more details), 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only
PDB Compounds: (E:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1qcre2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcre2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

SCOPe Domain Coordinates for d1qcre2:

Click to download the PDB-style file with coordinates for d1qcre2.
(The format of our PDB-style files is described here.)

Timeline for d1qcre2: