![]() | Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
![]() | Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) ![]() |
![]() | Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins) |
![]() | Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81497] (9 PDB entries) |
![]() | Domain d1qcre2: 1qcr E:1-69 [43675] Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrc2, d1qcrc3, d1qcrd2, d1qcrd3, d1qcre1, d1qcrf_, d1qcrg_, d1qcrh_, d1qcrj_, d1qcrk_ complexed with hem |
PDB Entry: 1qcr (more details), 2.7 Å
SCOP Domain Sequences for d1qcre2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qcre2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus)} shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs smsasadvl
Timeline for d1qcre2: