Details for d1qcre2

PDB Entry: 1qcr (more details), 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

SCOP Domain Sequences for d1qcre2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcre2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus)}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

SCOP Domain Coordinates for d1qcre2:

Click to download the PDB-style file with coordinates for d1qcre2.
(The format of our PDB-style files is described here.)

Timeline for d1qcre2: