SCOP 1.69: Domain d1be3j_: 1be3 J:

Lineage for d1be3j_ (1be3 J:)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family)

5. Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein)

6. Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
   interacts with cytochrome c1 and ISP

7. Species Cow (Bos taurus) [TaxId:9913] [81509] (12 PDB entries)

8. Domain d1be3j_: 1be3 J: [43671]
   Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c2, d1be3c3, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f_, d1be3g_, d1be3h_, d1be3k_

Details for d1be3j_

PDB Entry: 1be3, 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1be3j_:

Sequence; same for both SEQRES and ATOM records:

>d1be3j_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
nk

Timeline for d1be3j_:

• d1be3j_ first appeared (with stable ids) in SCOP 1.55, called d1be3j1
  
• d1be3j_ appears in SCOP 1.67
  
• d1be3j_ appears in SCOP 1.71
  
• d1be3j_ appears in the current release, SCOPe 2.08