SCOPe 2.06: Domain d1be3d3: 1be3 D:196-241

Lineage for d1be3d3 (1be3 D:196-241)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families)

5. Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)

6. Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81491] (18 PDB entries)
   Uniprot P00125

8. Domain d1be3d3: 1be3 D:196-241 [43666]
   Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c2, d1be3c3, d1be3d2, d1be3e1, d1be3e2, d1be3f_, d1be3g_, d1be3h_, d1be3i_, d1be3j_, d1be3k_
   complexed with fes, hec, hem

Details for d1be3d3

PDB Entry: 1be3, 3 Å

PDB Description: cytochrome bc1 complex from bovine

PDB Compounds: (D:) cytochrome bc1 complex

SCOPe Domain Sequences for d1be3d3:

Sequence; same for both SEQRES and ATOM records:

>d1be3d3 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

Timeline for d1be3d3:

• d1be3d3 first appeared (with stable ids) in SCOP 1.55
  
• d1be3d3 appears in SCOPe 2.05
  
• d1be3d3 appears in SCOPe 2.07
  
• d1be3d3 appears in the current release, SCOPe 2.08