Lineage for d1msld_ (1msl D:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519687Fold f.16: Gated mechanosensitive channel [81331] (1 superfamily)
    oligomeric transmembrane alpha-helical protein
  4. 519688Superfamily f.16.1: Gated mechanosensitive channel [81330] (1 family) (S)
  5. 519689Family f.16.1.1: Gated mechanosensitive channel [81329] (1 protein)
  6. 519690Protein Gated mechanosensitive channel [56904] (1 species)
    Large-conductance ion channel
  7. 519691Species Mycobacterium tuberculosis [TaxId:1773] [56905] (1 PDB entry)
  8. 519695Domain d1msld_: 1msl D: [43663]

Details for d1msld_

PDB Entry: 1msl (more details), 3.5 Å

PDB Description: structure of the mscl homologue from mycobacterium tuberculosis: a gated mechanosensitive channel.

SCOP Domain Sequences for d1msld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1msld_ f.16.1.1 (D:) Gated mechanosensitive channel {Mycobacterium tuberculosis}
argnivdlavavvigtaftalvtkftdsiitplinrigvnaqsdvgilrigigggqtidl
nvllsaainffliafavyflvvlpyntlrkkgeveqpgdtqvvllteir

SCOP Domain Coordinates for d1msld_:

Click to download the PDB-style file with coordinates for d1msld_.
(The format of our PDB-style files is described here.)

Timeline for d1msld_: