![]() | Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
![]() | Fold f.16: Gated mechanosensitive channel [81331] (1 superfamily) oligomeric transmembrane alpha-helical protein |
![]() | Superfamily f.16.1: Gated mechanosensitive channel [81330] (1 family) ![]() |
![]() | Family f.16.1.1: Gated mechanosensitive channel [81329] (1 protein) |
![]() | Protein Gated mechanosensitive channel [56904] (1 species) Large-conductance ion channel |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [56905] (1 PDB entry) |
![]() | Domain d1msld_: 1msl D: [43663] |
PDB Entry: 1msl (more details), 3.5 Å
SCOP Domain Sequences for d1msld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1msld_ f.16.1.1 (D:) Gated mechanosensitive channel {Mycobacterium tuberculosis} argnivdlavavvigtaftalvtkftdsiitplinrigvnaqsdvgilrigigggqtidl nvllsaainffliafavyflvvlpyntlrkkgeveqpgdtqvvllteir
Timeline for d1msld_:
![]() Domains from other chains: (mouse over for more information) d1msla_, d1mslb_, d1mslc_, d1msle_ |