Lineage for d1msld_ (1msl D:)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 87593Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 87594Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 88003Family f.2.1.11: Oligomeric gated channels [63383] (3 proteins)
  6. 88004Protein Gated mechanosensitive channel [56904] (1 species)
  7. 88005Species Mycobacterium tuberculosis [TaxId:1773] [56905] (1 PDB entry)
  8. 88009Domain d1msld_: 1msl D: [43663]

Details for d1msld_

PDB Entry: 1msl (more details), 3.5 Å

PDB Description: structure of the mscl homologue from mycobacterium tuberculosis: a gated mechanosensitive channel.

SCOP Domain Sequences for d1msld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1msld_ f.2.1.11 (D:) Gated mechanosensitive channel {Mycobacterium tuberculosis}
argnivdlavavvigtaftalvtkftdsiitplinrigvnaqsdvgilrigigggqtidl
nvllsaainffliafavyflvvlpyntlrkkgeveqpgdtqvvllteir

SCOP Domain Coordinates for d1msld_:

Click to download the PDB-style file with coordinates for d1msld_.
(The format of our PDB-style files is described here.)

Timeline for d1msld_: