SCOP 1.57: Domain d1mslb_: 1msl B:

Lineage for d1mslb_ (1msl B:)

1. Root: SCOP 1.57

2. Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (10 families)

5. Family f.2.1.11: Oligomeric gated channels [63383] (3 proteins)

6. Protein Gated mechanosensitive channel [56904] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [56905] (1 PDB entry)

8. Domain d1mslb_: 1msl B: [43661]

Details for d1mslb_

PDB Entry: 1msl, 3.5 Å

PDB Description: structure of the mscl homologue from mycobacterium tuberculosis: a gated mechanosensitive channel.

SCOP Domain Sequences for d1mslb_:

Sequence; same for both SEQRES and ATOM records:

>d1mslb_ f.2.1.11 (B:) Gated mechanosensitive channel {Mycobacterium tuberculosis}
argnivdlavavvigtaftalvtkftdsiitplinrigvnaqsdvgilrigigggqtidl
nvllsaainffliafavyflvvlpyntlrkkgeveqpgdtqvvllteir

Timeline for d1mslb_:

• d1mslb_ first appeared (with stable ids) in SCOP 1.55
  
• d1mslb_ appears in SCOP 1.59
  
• d1mslb_ last appears in SCOP 1.71