Lineage for d1msla_ (1msl A:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 267876Fold f.16: Gated mechanosensitive channel [81331] (1 superfamily)
    oligomeric transmembrane alpha-helical protein
  4. 267877Superfamily f.16.1: Gated mechanosensitive channel [81330] (1 family) (S)
  5. 267878Family f.16.1.1: Gated mechanosensitive channel [81329] (1 protein)
  6. 267879Protein Gated mechanosensitive channel [56904] (1 species)
    Large-conductance ion channel
  7. 267880Species Mycobacterium tuberculosis [TaxId:1773] [56905] (1 PDB entry)
  8. 267881Domain d1msla_: 1msl A: [43660]

Details for d1msla_

PDB Entry: 1msl (more details), 3.5 Å

PDB Description: structure of the mscl homologue from mycobacterium tuberculosis: a gated mechanosensitive channel.

SCOP Domain Sequences for d1msla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1msla_ f.16.1.1 (A:) Gated mechanosensitive channel {Mycobacterium tuberculosis}
argnivdlavavvigtaftalvtkftdsiitplinrigvnaqsdvgilrigigggqtidl
nvllsaainffliafavyflvvlpyntlrkkgeveqpgdtqvvllteir

SCOP Domain Coordinates for d1msla_:

Click to download the PDB-style file with coordinates for d1msla_.
(The format of our PDB-style files is described here.)

Timeline for d1msla_: