Lineage for d1msla_ (1msl A:)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201976Family f.2.1.11: Oligomeric gated channels [63383] (4 proteins)
  6. 201977Protein Gated mechanosensitive channel [56904] (1 species)
  7. 201978Species Mycobacterium tuberculosis [TaxId:1773] [56905] (1 PDB entry)
  8. 201979Domain d1msla_: 1msl A: [43660]

Details for d1msla_

PDB Entry: 1msl (more details), 3.5 Å

PDB Description: structure of the mscl homologue from mycobacterium tuberculosis: a gated mechanosensitive channel.

SCOP Domain Sequences for d1msla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1msla_ f.2.1.11 (A:) Gated mechanosensitive channel {Mycobacterium tuberculosis}
argnivdlavavvigtaftalvtkftdsiitplinrigvnaqsdvgilrigigggqtidl
nvllsaainffliafavyflvvlpyntlrkkgeveqpgdtqvvllteir

SCOP Domain Coordinates for d1msla_:

Click to download the PDB-style file with coordinates for d1msla_.
(The format of our PDB-style files is described here.)

Timeline for d1msla_: