SCOP 1.61: Domain d1f6gb_: 1f6g B:

Lineage for d1f6gb_ (1f6g B:)

1. Root: SCOP 1.61

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (13 families)

5. Family f.2.1.11: Oligomeric gated channels [63383] (4 proteins)

6. Protein Potassium channel protein [56901] (1 species)

7. Species Streptomyces lividans [TaxId:1916] [56902] (8 PDB entries)

8. Domain d1f6gb_: 1f6g B: [43657]

Details for d1f6gb_

PDB Entry: 1f6g

PDB Description: potassium channel (kcsa) full-length fold

SCOP Domain Sequences for d1f6gb_:

Sequence; same for both SEQRES and ATOM records:

>d1f6gb_ f.2.1.11 (B:) Potassium channel protein {Streptomyces lividans}
mppmlsgllarlvklllgrhgsalhwaaagaatvllvivllagsylavlaergapgaqli
typaalwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
rrghfvrhsekaaeeaytrttralherfdrlermlddnrr

Timeline for d1f6gb_:

• d1f6gb_ first appeared (with stable ids) in SCOP 1.55
  
• d1f6gb_ appears in SCOP 1.59
  
• d1f6gb_ appears in SCOP 1.63
  
• d1f6gb_ appears in the current release, SCOPe 2.08