SCOPe 2.03: Domain d1f6ga_: 1f6g A:

Lineage for d1f6ga_ (1f6g A:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces coelicolor [TaxId:1902] [56902] (20 PDB entries)
   identical sequence to Streptomyces lividans, TaxId: 1916
   Uniprot Q54397 22-124

8. Domain d1f6ga_: 1f6g A: [43656]
   full-length fold; CA-atoms only

Details for d1f6ga_

PDB Entry: 1f6g

PDB Description: potassium channel (kcsa) full-length fold

PDB Compounds: (A:) Voltage-gated potassium channel

SCOPe Domain Sequences for d1f6ga_:

Sequence; same for both SEQRES and ATOM records:

>d1f6ga_ f.14.1.1 (A:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
mppmlsgllarlvklllgrhgsalhwaaagaatvllvivllagsylavlaergapgaqli
typaalwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
rrghfvrhsekaaeeaytrttralherfdrlermlddnrr

Timeline for d1f6ga_:

• d1f6ga_ first appeared (with stable ids) in SCOP 1.55
  
• d1f6ga_ appears in SCOPe 2.02
  
• d1f6ga_ appears in SCOPe 2.04
  
• d1f6ga_ appears in the current release, SCOPe 2.08