SCOP 1.73: Domain d1bl8b_: 1bl8 B:

Lineage for d1bl8b_ (1bl8 B:)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)

6. Protein Potassium channel protein [56901] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [56902] (27 PDB entries)
   identical sequence to Streptomyces lividans, TaxId: 1916

8. Domain d1bl8b_: 1bl8 B: [43653]

Details for d1bl8b_

PDB Entry: 1bl8, 3.2 Å

PDB Description: potassium channel (kcsa) from streptomyces lividans

PDB Compounds: (B:) protein (potassium channel protein)

SCOP Domain Sequences for d1bl8b_:

Sequence; same for both SEQRES and ATOM records:

>d1bl8b_ f.14.1.1 (B:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq

Timeline for d1bl8b_:

• d1bl8b_ first appeared (with stable ids) in SCOP 1.55
  
• d1bl8b_ appears in SCOP 1.71
  
• d1bl8b_ appears in SCOP 1.75
  
• d1bl8b_ appears in the current release, SCOPe 2.08