SCOPe 2.05: Domain d1bl8a_: 1bl8 A:

Lineage for d1bl8a_ (1bl8 A:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces coelicolor [TaxId:1902] [56902] (17 PDB entries)
   identical sequence to Streptomyces lividans, TaxId: 1916
   Uniprot Q54397 22-124

8. Domain d1bl8a_: 1bl8 A: [43652]
   residues 1-125
   complexed with k

Details for d1bl8a_

PDB Entry: 1bl8, 3.2 Å

PDB Description: potassium channel (kcsa) from streptomyces lividans

PDB Compounds: (A:) protein (potassium channel protein)

SCOPe Domain Sequences for d1bl8a_:

Sequence; same for both SEQRES and ATOM records:

>d1bl8a_ f.14.1.1 (A:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq

Timeline for d1bl8a_:

• d1bl8a_ first appeared (with stable ids) in SCOP 1.55
  
• d1bl8a_ appears in SCOPe 2.04
  
• d1bl8a_ appears in SCOPe 2.06
  
• d1bl8a_ appears in the current release, SCOPe 2.08