SCOP 1.75: Domain d1fqya_: 1fqy A:

Lineage for d1fqya_ (1fqy A:)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.19: Aquaporin-like [81339] (1 superfamily)
   core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices

4. Superfamily f.19.1: Aquaporin-like [81338] (1 family)

5. Family f.19.1.1: Aquaporin-like [56895] (4 proteins)
   duplication: consist of two similar structural parts

6. Protein Aquaporin-1 [56896] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56897] (3 PDB entries)

8. Domain d1fqya_: 1fqy A: [43649]

Details for d1fqya_

PDB Entry: 1fqy, 3.8 Å

PDB Description: structure of aquaporin-1 at 3.8 a resolution by electron crystallography

PDB Compounds: (A:) aquaporin-1

SCOP Domain Sequences for d1fqya_:

Sequence; same for both SEQRES and ATOM records:

>d1fqya_ f.19.1.1 (A:) Aquaporin-1 {Human (Homo sapiens) [TaxId: 9606]}
klfwravvaeflattlfvfisigsalgfkypvgnnqtavqdnvkvslafglsiatlaqsv
ghisgahlnpavtlglllscqisifralmyiiaqcvgaivatailsgitssltgnslgrn
dladgvnsgqglgieiigtlqlvlcvlattdrrrrdlggsaplaiglsvalghllaidyt
gcginparsfgsavithnfsnhwifwvgpfiggalavliydfilap

Timeline for d1fqya_:

• d1fqya_ first appeared (with stable ids) in SCOP 1.55
  
• d1fqya_ appears in SCOP 1.73
  
• d1fqya_ appears in SCOPe 2.01
  
• d1fqya_ appears in the current release, SCOPe 2.08