SCOPe 2.08: Domain d1a91a_: 1a91 A:

Lineage for d1a91a_ (1a91 A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.1: Rotary ATPase ring subunits [81333] (2 families)
   automatically mapped to Pfam PF00137

5. Family f.17.1.1: F1F0 ATP synthase subunit C or V-type proton ATPase subunit c [81332] (3 proteins)

6. Protein F1F0 ATP synthase subunit C [56891] (1 species)

7. Species Escherichia coli [TaxId:562] [56892] (6 PDB entries)

8. Domain d1a91a_: 1a91 A: [43635]

Details for d1a91a_

PDB Entry: 1a91

PDB Description: subunit c of the f1fo atp synthase of escherichia coli; nmr, 10 structures

PDB Compounds: (A:) f1fo ATPase subunit c

SCOPe Domain Sequences for d1a91a_:

Sequence; same for both SEQRES and ATOM records:

>d1a91a_ f.17.1.1 (A:) F1F0 ATP synthase subunit C {Escherichia coli [TaxId: 562]}
menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
daipmiavglglyvmfava

Timeline for d1a91a_:

• d1a91a_ first appeared (with stable ids) in SCOP 1.55, called d1a91__
  
• d1a91a_ appears in SCOPe 2.07