SCOPe 2.06: Domain d1ffth2: 1fft H:25-203

Lineage for d1ffth2 (1fft H:25-203)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family)
   automatically mapped to Pfam PF00510

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Cytochrome O ubiquinol oxidase, subunit III [81450] (1 species)

7. Species Escherichia coli [TaxId:562] [81449] (1 PDB entry)

8. Domain d1ffth2: 1fft H:25-203 [43632]
   Other proteins in same PDB: d1ffta_, d1fftb1, d1fftb2, d1fftc3, d1fftf_, d1fftg1, d1fftg2, d1ffth3
   complexed with cu, hem, heo

Details for d1ffth2

PDB Entry: 1fft, 3.5 Å

PDB Description: the structure of ubiquinol oxidase from escherichia coli

PDB Compounds: (H:) ubiquinol oxidase

SCOPe Domain Sequences for d1ffth2:

Sequence; same for both SEQRES and ATOM records:

>d1ffth2 f.25.1.1 (H:25-203) Cytochrome O ubiquinol oxidase, subunit III {Escherichia coli [TaxId: 562]}
kifgfwiylmsdcilfsilfatyavlvngtaggptgkdifelpfvlvetflllfssityg
maaiamyknnksqviswlaltwlfgagfigmeiyefhhlivngmgpdrsgflsaffalvg
thglhvtsgliwmavlmvqiarrgltstnrtrimclslfwhfldvvwicvftvvylmga

Timeline for d1ffth2:

• d1ffth2 first appeared (with stable ids) in SCOP 1.55, called d1ffth1
  
• d1ffth2 was called d1ffth_ in SCOPe 2.05
  
• d1ffth2 appears in SCOPe 2.07
  
• d1ffth2 appears in the current release, SCOPe 2.08