Class f: Membrane and cell surface proteins and peptides [56835] (36 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (2 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) |
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins) |
Protein Cytochrome O ubiquinol oxidase, subunit II [81462] (1 species) |
Species Escherichia coli [TaxId:562] [81461] (1 PDB entry) |
Domain d1fftg2: 1fft G:27-117 [43631] Other proteins in same PDB: d1ffta_, d1fftb1, d1fftc_, d1fftf_, d1fftg1, d1ffth_ complexed with cu, hem, heo |
PDB Entry: 1fft (more details)
SCOP Domain Sequences for d1fftg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fftg2 f.17.2.1 (G:27-117) Cytochrome O ubiquinol oxidase, subunit II {Escherichia coli} salldpkgqigleqrsliltafglmlivvipailmavgfawkyrasnkdakyspnwshsn kveavvwtvpiliiiflavltwktthaleps
Timeline for d1fftg2: