Lineage for d1fftf_ (1fft F:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426591Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 426592Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 426593Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (4 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 426606Protein Cytochrome O ubiquinol oxidase, subunit I [81440] (1 species)
  7. 426607Species Escherichia coli [TaxId:562] [81439] (1 PDB entry)
  8. 426609Domain d1fftf_: 1fft F: [43630]
    Other proteins in same PDB: d1fftb1, d1fftb2, d1fftc_, d1fftg1, d1fftg2, d1ffth_
    complexed with cu, hem, heo

Details for d1fftf_

PDB Entry: 1fft (more details), 3.5 Å

PDB Description: the structure of ubiquinol oxidase from escherichia coli

SCOP Domain Sequences for d1fftf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fftf_ f.24.1.1 (F:) Cytochrome O ubiquinol oxidase, subunit I {Escherichia coli}
vdhkrlgimyiivaivmllrgfadaimmrsqqalasageagflpphhydqiftahgvimi
ffvampfviglmnlvvplqigardvafpflnnlsfwftvvgvilvnvslgvgefaqtgwl
aypplsgieyspgvgvdywiwslqlsgigttltginffvtilkmrapgmtmfkmpvftwa
slcanvliiasfpiltvtvalltldrylgthfftndmggnmmmyinliwawghpevyili
lpvfgvfseiaatfsrkrlfgytslvwatvcitvlsfivwlhhfftmgaganvnaffgit
tmiiaiptgvkifnwlftmyqgrivfhsamlwtigfivtfsvggmtgvllavpgadfvlh
nslfliahfhnviiggvvfgcfagmtywwpkafgfklnetwgkrafwfwiigffvafmpl
yalgfmgmtrrlsqqidpqfhtmlmiaasgavlialgilclviqmyvsirdrdqnrdltg
dpwggrtlewatsspppfynf

SCOP Domain Coordinates for d1fftf_:

Click to download the PDB-style file with coordinates for d1fftf_.
(The format of our PDB-style files is described here.)

Timeline for d1fftf_: