Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) |
Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
Protein Cytochrome O ubiquinol oxidase, subunit III [81450] (1 species) |
Species Escherichia coli [TaxId:562] [81449] (1 PDB entry) |
Domain d1fftc_: 1fft C: [43629] Other proteins in same PDB: d1ffta_, d1fftb1, d1fftb2, d1fftf_, d1fftg1, d1fftg2 |
PDB Entry: 1fft (more details), 3.5 Å
SCOP Domain Sequences for d1fftc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fftc_ f.25.1.1 (C:) Cytochrome O ubiquinol oxidase, subunit III {Escherichia coli} hdaggtkifgfwiylmsdcilfsilfatyavlvngtaggptgkdifelpfvlvetflllf ssitygmaaiamyknnksqviswlaltwlfgagfigmeiyefhhlivngmgpdrsgflsa ffalvgthglhvtsgliwmavlmvqiarrgltstnrtrimclslfwhfldvvwicvftvv ylmga
Timeline for d1fftc_: