Lineage for d1ehkc_ (1ehk C:)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340729Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 340838Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) (S)
  5. 340839Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (1 protein)
  6. 340840Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species)
    functionally important, corresponds to the first helix of the aa3 type subunit II absent in the the ba3 type subunit II
  7. 340841Species Thermus thermophilus [TaxId:274] [81470] (1 PDB entry)
  8. 340842Domain d1ehkc_: 1ehk C: [43626]
    Other proteins in same PDB: d1ehka_, d1ehkb1, d1ehkb2
    complexed with 1cu, bng, cua, has, hem

Details for d1ehkc_

PDB Entry: 1ehk (more details), 2.4 Å

PDB Description: crystal structure of the aberrant ba3-cytochrome-c oxidase from thermus thermophilus

SCOP Domain Sequences for d1ehkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehkc_ f.23.9.1 (C:) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus}
eekpkgalavilvltltilvfwlgvyavffarg

SCOP Domain Coordinates for d1ehkc_:

Click to download the PDB-style file with coordinates for d1ehkc_.
(The format of our PDB-style files is described here.)

Timeline for d1ehkc_: