Lineage for d1qlec_ (1qle C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027151Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 3027152Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) (S)
    automatically mapped to Pfam PF00510
  5. 3027153Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 3027154Protein Bacterial aa3 type cytochrome c oxidase subunit III [81448] (2 species)
  7. 3027155Species Paracoccus denitrificans [TaxId:266] [81446] (1 PDB entry)
  8. 3027156Domain d1qlec_: 1qle C: [43622]
    Other proteins in same PDB: d1qlea_, d1qleb1, d1qleb2, d1qled_, d1qleh_, d1qlel_
    complexed with ca, cu, cua, hea, mn, pc1

Details for d1qlec_

PDB Entry: 1qle (more details), 3 Å

PDB Description: cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment
PDB Compounds: (C:) cytochrome c oxidase polypeptide III

SCOPe Domain Sequences for d1qlec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlec_ f.25.1.1 (C:) Bacterial aa3 type cytochrome c oxidase subunit III {Paracoccus denitrificans [TaxId: 266]}
ahvknhdyqilppsiwpffgaigafvmltgavawmkgitffglpvegpwmfliglvgvly
vmfgwwadvvnegetgehtpvvriglqygfilfimsevmffvawfwafiknalypmgpds
pikdgvwppegivtfdpwhlplintlilllsgvavtwahhafvlegdrkttinglivavi
lgvcftglqayeyshaafgladtvyagafymatgfhgahviigtiflfvclirllkgqmt
qkqhvgfeaaawywhfvdvvwlflfvviyiwgr

SCOPe Domain Coordinates for d1qlec_:

Click to download the PDB-style file with coordinates for d1qlec_.
(The format of our PDB-style files is described here.)

Timeline for d1qlec_: