SCOP 1.71: Domain d1ocod_: 1oco D:

Lineage for d1ocod_ (1oco D:)

1. Root: SCOP 1.71

2. Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family)

5. Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81403] (7 PDB entries)

8. Domain d1ocod_: 1oco D: [43601]
   Other proteins in same PDB: d1ocoa_, d1ocob1, d1ocob2, d1ococ_, d1ocoe_, d1ocof_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocop_, d1ocor_, d1ocos_, d1ocot_, d1ocou_, d1ocov_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_

Details for d1ocod_

PDB Entry: 1oco, 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state

SCOP Domain Sequences for d1ocod_:

Sequence; same for both SEQRES and ATOM records:

>d1ocod_ f.23.1.1 (D:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus)}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

Timeline for d1ocod_:

• d1ocod_ first appeared (with stable ids) in SCOP 1.55, called d1ocod1
  
• d1ocod_ appears in SCOP 1.69
  
• d1ocod_ appears in SCOP 1.73
  
• d1ocod_ appears in the current release, SCOPe 2.08