SCOP 1.61: Domain d1ococ1: 1oco C:

Lineage for d1ococ1 (1oco C:)

1. Root: SCOP 1.61

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (13 families)

5. Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins)

6. Protein Cytochrome c oxidase [56884] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56885] (5 PDB entries)

8. Domain d1ococ1: 1oco C: [43600]
   Other proteins in same PDB: d1ocob1, d1ocoe_, d1ocof_, d1ocoh_, d1ocoo1, d1ocor_, d1ocos_, d1ocou_

Details for d1ococ1

PDB Entry: 1oco, 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state

SCOP Domain Sequences for d1ococ1:

Sequence; same for both SEQRES and ATOM records:

>d1ococ1 f.2.1.3 (C:) Cytochrome c oxidase {Cow (Bos taurus)}
mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeagaw
ywhfvdvvwlflyvsiywwgs

Timeline for d1ococ1:

• d1ococ1 first appeared (with stable ids) in SCOP 1.55
  
• d1ococ1 appears in SCOP 1.59
  
• d1ococ1 is called d1ococ_ in SCOP 1.63
  
• d1ococ1 appears in the current release, SCOPe 2.08, called d1ococ_