Lineage for d1ocoa_ (1oco A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3026966Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 3026967Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 3026968Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 3027023Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)
  7. 3027024Species Cow (Bos taurus) [TaxId:9913] [81432] (40 PDB entries)
  8. 3027085Domain d1ocoa_: 1oco A: [43598]
    Other proteins in same PDB: d1ocob1, d1ocob2, d1ococ_, d1ocod_, d1ocoe_, d1ocof_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocoo1, d1ocoo2, d1ocop_, d1ocoq_, d1ocor_, d1ocos_, d1ocot_, d1ocou_, d1ocov_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_
    complexed with cmo, cu, hea, mg, na, zn

Details for d1ocoa_

PDB Entry: 1oco (more details), 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state
PDB Compounds: (A:) cytochrome c oxidase

SCOPe Domain Sequences for d1ocoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocoa_ f.24.1.1 (A:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

SCOPe Domain Coordinates for d1ocoa_:

Click to download the PDB-style file with coordinates for d1ocoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ocoa_: