SCOP 1.67: Domain d1oczz_: 1ocz Z:

Lineage for d1oczz_ (1ocz Z:)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family)

5. Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81428] (7 PDB entries)

8. Domain d1oczz_: 1ocz Z: [43597]
   Other proteins in same PDB: d1ocza_, d1oczb1, d1oczb2, d1oczc_, d1oczd_, d1ocze_, d1oczf_, d1oczg_, d1oczh_, d1oczi_, d1oczj_, d1oczk_, d1oczl_, d1oczn_, d1oczo1, d1oczo2, d1oczp_, d1oczq_, d1oczr_, d1oczs_, d1oczt_, d1oczu_, d1oczv_, d1oczw_, d1oczx_, d1oczy_
   complexed with azi, cu, hea, mg, na, zn

Details for d1oczz_

PDB Entry: 1ocz, 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state

SCOP Domain Sequences for d1oczz_:

Sequence; same for both SEQRES and ATOM records:

>d1oczz_ f.23.7.1 (Z:) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus)}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

Timeline for d1oczz_:

• d1oczz_ first appeared (with stable ids) in SCOP 1.55, called d1oczz1
  
• d1oczz_ appears in SCOP 1.65
  
• d1oczz_ appears in SCOP 1.69
  
• d1oczz_ appears in the current release, SCOPe 2.08