SCOPe 2.07: Domain d1oczq_: 1ocz Q:

Lineage for d1oczq_ (1ocz Q:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family)
   automatically mapped to Pfam PF02936

5. Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81403] (28 PDB entries)

8. Domain d1oczq_: 1ocz Q: [43591]
   Other proteins in same PDB: d1ocza_, d1oczb1, d1oczb2, d1oczc_, d1ocze_, d1oczf_, d1oczg_, d1oczh_, d1oczi_, d1oczj_, d1oczk_, d1oczl_, d1oczm_, d1oczn_, d1oczo1, d1oczo2, d1oczp_, d1oczr_, d1oczs_, d1oczt_, d1oczu_, d1oczv_, d1oczw_, d1oczx_, d1oczy_, d1oczz_
   complexed with azi, cu, hea, mg, na, zn

Details for d1oczq_

PDB Entry: 1ocz, 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state

PDB Compounds: (Q:) cytochrome c oxidase

SCOPe Domain Sequences for d1oczq_:

Sequence; same for both SEQRES and ATOM records:

>d1oczq_ f.23.1.1 (Q:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

Timeline for d1oczq_:

• d1oczq_ first appeared (with stable ids) in SCOP 1.55, called d1oczq1
  
• d1oczq_ appears in SCOPe 2.06
  
• d1oczq_ appears in the current release, SCOPe 2.08