| Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
| Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) ![]() |
| Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins) |
| Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [81454] (14 PDB entries) |
| Domain d1occo2: 1occ O:1-90 [43569] Other proteins in same PDB: d1occa_, d1occb1, d1occc_, d1occd_, d1occe_, d1occf_, d1occg_, d1occh_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occp_, d1occq_, d1occr_, d1occs_, d1occt_, d1occu_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_ complexed with cu, hea, mg, zn |
PDB Entry: 1occ (more details), 2.8 Å
SCOP Domain Sequences for d1occo2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1occo2 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei
Timeline for d1occo2:
View in 3DDomains from other chains: (mouse over for more information) d1occa_, d1occb1, d1occb2, d1occc_, d1occd_, d1occe_, d1occf_, d1occg_, d1occh_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occp_, d1occq_, d1occr_, d1occs_, d1occt_, d1occu_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_ |