SCOPe 2.06: Domain d1occj_: 1occ J:

Lineage for d1occj_ (1occ J:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family)
   automatically mapped to Pfam PF02238

5. Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81416] (36 PDB entries)

8. Domain d1occj_: 1occ J: [43564]
   Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occc_, d1occd_, d1occe_, d1occf_, d1occg_, d1occh_, d1occi_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occp_, d1occq_, d1occr_, d1occs_, d1occt_, d1occu_, d1occv_, d1occx_, d1occy_, d1occz_
   complexed with cu, hea, mg, zn

Details for d1occj_

PDB Entry: 1occ, 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

PDB Compounds: (J:) cytochrome c oxidase

SCOPe Domain Sequences for d1occj_:

Sequence; same for both SEQRES and ATOM records:

>d1occj_ f.23.4.1 (J:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfp

Timeline for d1occj_:

• d1occj_ first appeared (with stable ids) in SCOP 1.55, called d1occj1
  
• d1occj_ appears in SCOPe 2.05
  
• d1occj_ appears in SCOPe 2.07
  
• d1occj_ appears in the current release, SCOPe 2.08