SCOPe 2.05: Domain d1ocrx_: 1ocr X:

Lineage for d1ocrx_ (1ocr X:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
   not a true fold

4. Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family)
   automatically mapped to Pfam PF05392

5. Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81420] (10 PDB entries)

8. Domain d1ocrx_: 1ocr X: [43555]
   Other proteins in same PDB: d1ocra_, d1ocrb1, d1ocrb2, d1ocrc_, d1ocrd_, d1ocre_, d1ocrf_, d1ocrg_, d1ocrh_, d1ocri_, d1ocrj_, d1ocrl_, d1ocrm_, d1ocrn_, d1ocro1, d1ocro2, d1ocrp_, d1ocrq_, d1ocrr_, d1ocrs_, d1ocrt_, d1ocru_, d1ocrv_, d1ocrw_, d1ocry_, d1ocrz_
   complexed with cu, hea, mg, na, zn

Details for d1ocrx_

PDB Entry: 1ocr, 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state

PDB Compounds: (X:) cytochrome c oxidase

SCOPe Domain Sequences for d1ocrx_:

Sequence; same for both SEQRES and ATOM records:

>d1ocrx_ f.23.5.1 (X:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

Timeline for d1ocrx_:

• d1ocrx_ first appeared (with stable ids) in SCOP 1.55, called d1ocrx1
  
• d1ocrx_ appears in SCOPe 2.04
  
• d1ocrx_ appears in SCOPe 2.06
  
• d1ocrx_ appears in the current release, SCOPe 2.08